DPCstruct | MC28885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 213 ± 22 aa |
| Standard deviation of domain lengths | 22.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U1ISJ3 | 2-243 | RIFSLLVATIPLVLLAGCGAAQEHAAPAPMGPPHAEEAACSPLPDEPARQRAVAMPAAEREALEKRLEEGPVAVKLEGCKLVVVPAC… |
| A0A7Y4ZV61 | 1-235 | MVAALLLGGCSATPASTPPSSADAVVMVGSAAAGACPIMPDARPYAFGLDPTELSSFESQAKTNVVFVAAEGCSLRVLPSCDAAASP… |
| A0A017T4F1 | 10-211 | None |
| A0A1V5X2S7 | 5-264 | None |
| A0A1M3NGT5 | 1-223 | None |
| A0A849ZHD0 | 1-189 | None |
| A0A2S9Y7P0 | 1-197 | None |
| A0A1I2FWD0 | 1-199 | None |
| A0A2Z4FGK6 | 3-197 | None |
| A0A2N2ITQ5 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.