DPCstruct | MC28881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 137 ± 24 aa |
| Standard deviation of domain lengths | 24.34 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05591 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9IFS9 | 1-115 | LLYAAKLNNEEDADVTPVRCSNMKEVFEKFHPSFSAELESTEGEQVNADFTIKAMKDFGSKELIEQNDYLKKVYYGKEILNDLEKQL… |
| A0A3C1SRF0 | 5-137 | MEFQLDLPKSVAAPRRHDPSAAPRFLIMADLSGRGQREASSALADLADRPLLKVDADSLSAVMARLAPKLRLPSNAGTGVTTTAISF… |
| A0A4Y5RHE2 | 49-192 | None |
| A0A841JV49 | 1-202 | None |
| A0A538QA29 | 38-215 | None |
| A0A1B8YI14 | 9-160 | None |
| A0A2G2G6P7 | 7-157 | None |
| A2VTE2 | 60-196 | None |
| A0A6I1ITG0 | 1-99 | None |
| A0A2V9Y0I8 | 3-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.