DPCstruct | MC2888
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 204 ± 25 aa |
| Standard deviation of domain lengths | 25.11 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9CVX0 | 1-143 | MSVGGTSGITAVEISPRFADGIAGNEMIGLKVDPVLKGTTGDLTGSVRAIESNLDFGLGSTRTISGDVVGFRIFYQAAPGMAVTGNE… |
| A0A0F9T756 | 4-228 | PVRDLYNVVVGTVTAGKPVVPDEEGGLDTFKAKKGSHLGLQVQSNDKQVRINHRSYDNATGDTIGYTSKPNQTVTTTGDVYGAQMQP… |
| A0A0F9SIL7 | 143-328 | None |
| A0A0F9EMH1 | 1-187 | None |
| A0A3C1F7E0 | 1-213 | None |
| A0A0G1FPR9 | 1-231 | None |
| A0A3C1GPI0 | 78-296 | None |
| A0A6M3IEJ2 | 156-374 | None |
| A0A0F9CZW3 | 8-215 | None |
| A0A0F9CT48 | 33-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.