DPCstruct | MC28877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 362 ± 44 aa |
| Standard deviation of domain lengths | 43.92 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 62.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A1WW54 | 2-360 | KDECETESCCSSVESFPDEERVLLRISERLRQYLEYDHDMIVKYCKQHALPARIPVVAILENFVKQSVVKLVFSTTQVESTRRRTTQ… |
| G3X992 | 1-371 | MATLGCAPKDDGEGKDEGGSDRGDGDSKPKGKKEVEPHTRREADERAMRIPIPEVLQQRLADDCYYINRRRRLVRLPCQTNVGAILE… |
| K7GS61 | 195-591 | None |
| A0A2R5LIS5 | 150-583 | None |
| A0A139WD89 | 250-568 | None |
| Q28I09 | 1-354 | None |
| A0A6P8J1D6 | 131-449 | None |
| A0A1A9Z361 | 126-508 | None |
| A0A6A4WR00 | 81-361 | None |
| A0A3S2NWA5 | 13-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.