DPCstruct | MC28875
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 44 ± 3 aa |
| Standard deviation of domain lengths | 3.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 83.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E0CYB6 | 1-44 | MKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKFTVI |
| A0A402F6P6 | 1-43 | MKVTVCFGRTRVVVPCGDGNMKVSSLVEQAATRYRKAIAKVSG |
| A0A3B4AA39 | 1-49 | None |
| E0CXD3 | 1-40 | None |
| A0A5A9N6W5 | 1-49 | None |
| A0A3Q2DW82 | 1-49 | None |
| A0A3Q3GGR5 | 1-42 | None |
| A0A4Z2IAZ1 | 84-126 | None |
| A0A3M0JV82 | 1-40 | None |
| A0A4Z2F4R8 | 91-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.