DPCstruct | MC28873
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 156 ± 40 aa |
| Standard deviation of domain lengths | 39.52 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 89.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A824XYA5 | 27-154 | IELLIIDSHSTFDTNCYKDITLTITNSNVFKILIKLSDNLKLIDNIIKELKLYFFNFNKTLKQKLVQEKKIRIKEQQYIDIYKHDPY… |
| A0A6L7D6Y3 | 190-383 | VANHFHFTPPSDKKIFNDRINRNRGVLINLPTTLVAANSDIANAFCNGSENTQNLASLDSKDSLNIHIGTYQDFITNGSFIDISSEF… |
| A0A4V7IEA7 | 459-655 | None |
| A0A824BSR1 | 18-133 | None |
| A0A823VRY9 | 33-228 | None |
| A0A823U6K6 | 4-116 | None |
| A0A823TI35 | 1-103 | None |
| A0A6F9LIP6 | 3-132 | None |
| A0A824GW28 | 1-97 | None |
| A0A0A8HWL3 | 437-591 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.