DPCstruct | MC28871
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 182 ± 36 aa |
| Standard deviation of domain lengths | 35.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A824WRT5 | 3-151 | YEIDNEGYFTSEFNKAAGIPEDIKIHSSTMENFIKAQNNGILQSYTNIDIAKTVGNAYKIVSQLIEKTPELKGKSSFSKEDLANYFP… |
| A0A826EVR9 | 3-204 | TSTNTAYGYSVDKDGYMGSDFNKAAGLPEDFKIHKSTLDEIYSFNTSFKEHTANDLGVSNYYTNIDMADTIRQYYSKFNQIINHSFG… |
| U2GFM7 | 63-248 | None |
| J4VB41 | 55-226 | None |
| A0A2U8FE27 | 122-259 | None |
| A0A825KWD5 | 40-231 | None |
| A0A562XED4 | 23-285 | None |
| A0A825M3I6 | 75-291 | None |
| A0A222MZK4 | 37-209 | None |
| A0A222MYQ5 | 1-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.