DPCstruct | MC28870
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.39 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 62.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M6K8W5 | 76-140 | AITLEGNTQIIPLGPVASQVAIKQLGTNGGGYFGVNASHPFENPSPISNFLQMFSILILPGACVF |
| T1ACT2 | 78-141 | IPIGPVSSLEGIKNIGTNGGGFYGANAGYPFENPNWISNIVEVISFTIIPMGSIFALGRVLESR |
| A0A117LS67 | 135-198 | None |
| G5PZU4 | 1-58 | None |
| A0A495TYM9 | 86-152 | None |
| A0A7H4LX86 | 70-140 | None |
| A0A377TNA8 | 75-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.