DPCstruct | MC2887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Standard deviation of domain lengths | 5.86 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6KUS0 | 1-50 | MYSYNDFERLFVRYKAEVVPVGISIQKFCTANKVPYNLFERWYKDTRHKI |
| A0A1H8RJ95 | 15-75 | MYSSNDFERLFIRYKAEGLASGESIISFCTKNKVPYNLFEKWYKDTRHKLVPVQVDGLPSL |
| A0A413UU46 | 1-62 | None |
| A0A6F9ZF08 | 1-67 | None |
| R9I8D3 | 1-60 | None |
| G5SQJ5 | 1-58 | None |
| I8W4I4 | 1-60 | None |
| A0A0E2AU40 | 1-62 | None |
| A0A412UC22 | 1-62 | None |
| I8VU85 | 1-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.