DPCstruct | MC28869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 166 ± 23 aa |
| Standard deviation of domain lengths | 22.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L5EQ18 | 146-305 | WAQKKKHDSAFALAFQGVRNNAENFKVRVLQEHAGNSAALVSLADLQEKAKTIFGPSPMLEPRVVLPSFDALLSHESNPILSKRVLG… |
| A0A824Q6F9 | 41-217 | WKIKQNHSDNFKDFFEGKMGSKESFLNFIKSKIGEVLSLDVINQNINLEELKKQYNILTDATQVKLENINEIPNIEFKNIENNLMFN… |
| A0A6N2ZBS2 | 133-303 | None |
| M3LQF5 | 121-324 | None |
| W9T5H9 | 5-141 | None |
| A0A2T1JFJ0 | 2-170 | None |
| A0A1Q9GY97 | 1-128 | None |
| W6QY85 | 2-148 | None |
| A0A085L010 | 93-271 | None |
| A0A450WZ95 | 146-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.