DPCstruct | MC28868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 286 ± 53 aa |
| Standard deviation of domain lengths | 53.03 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 17.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7D6Y3 | 5-344 | YNFVYFSNGSSASAANLYYFEISHALTNPYWLGDCEKYIKDYTLLLHHKNEYIFLSFHPLVSTKNLFLFNKKVDMYYIARDPIEKLQ… |
| A0A824NY99 | 65-303 | HIVSLSCNYKDTVLLVRDPISIQKTMLNHISYLYSRESLTIKPNDQNSINCFLDQWIYFFGSNKPNLNTLCDKWLYDNTIFAYSAII… |
| A0A2U8FC03 | 522-773 | None |
| A0A4U7BT49 | 2-207 | None |
| A0A6N4RHD9 | 190-493 | None |
| A0A4V7IEA7 | 340-620 | None |
| A0A0A8HWL3 | 245-549 | None |
| A0A0S2CGG5 | 3-259 | None |
| A0A6N6IGA2 | 11-226 | None |
| A0A1G0HSC5 | 40-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.