DPCstruct | MC28865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 205 ± 37 aa |
| Standard deviation of domain lengths | 37.10 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0HSV0 | 15-239 | SRCVVCSRPLRPDEAHRTACHRCEHHIRAWLRELPLQLPILEVFLHPSAPRPGTGRPGPGGRPAPPVRADVLNLLGPGAGRPDDGPD… |
| A0A438M6A0 | 1-208 | MTPAEETPTLVTELKALLPRLQELLPEPVADPTKGTMSHHKISGSPAPWHPEAGGVLMTIRAGVRELEDDLRYHVTGHTGEGRGGSD… |
| A0A2T0PSU6 | 3-229 | None |
| A0A7W8VCV2 | 3-202 | None |
| A0A5S5CLJ1 | 28-294 | None |
| A0A4P8PRR7 | 45-293 | None |
| A0A847A4N1 | 4-248 | None |
| A0A8B0DG57 | 4-198 | None |
| A0A0N1GDS8 | 3-180 | None |
| A0A2W1UFM7 | 15-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.