DPCstruct | MC28861
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 51 ± 6 aa |
| Standard deviation of domain lengths | 5.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 59.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9APY5 | 1-46 | MDIVIRFDGPPSHKSGRFVEVETLDGRSIKVGEWIQDGSDWLLKLD |
| A0A7W7QDK9 | 7-55 | VINIVFDGPPLHEAPRFVEVEDDEGHPIRVGEWVPRDDGFWALRIECTA |
| A0A3E0D3C4 | 253-299 | None |
| A0A7T7VQN2 | 67-131 | None |
| A0A0P0E9Y8 | 47-92 | None |
| A0A0F9EDR8 | 70-116 | None |
| A0A350XSY6 | 261-317 | None |
| A0A6M3L6N6 | 38-92 | None |
| A0A0D8HVW8 | 279-324 | None |
| A0A0F9BDS7 | 2-49 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.