DPCstruct | MC28858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 133 ± 19 aa |
| Standard deviation of domain lengths | 19.30 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.96 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 37.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7Q9I1 | 8-128 | DSDLLPSADTLVDRGVEDVLDEGYSPAERPSDFSTEHEALDARLSRELPEGGPEDGDGLGDASDTDGELYDDEVGVARSGRLVAEDE… |
| A0A7V9F6Y3 | 13-134 | EQLDQMQPEDTLLDRGTDDILDEGYSPPERYSAAERFGNTATEQREGETLDQRIAQEEPDVAVDYSDEFLDDGEVGTERAGRLVDPD… |
| A0A1H1NB18 | 26-171 | None |
| A0A1H6DJF1 | 3-98 | None |
| A0A2W6PPV4 | 38-181 | None |
| A0A511Z040 | 14-150 | None |
| A0A6G3VJZ3 | 1-120 | None |
| Q47N12 | 29-165 | None |
| A0A0Q9C8I5 | 18-131 | None |
| A0A401MT38 | 195-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.