DPCstruct | MC28857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 102 ± 17 aa |
| Standard deviation of domain lengths | 16.82 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.34 |
| Pfam Score | 99.44 |
| Assigned Pfam label(s) | CL0123- CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3ZAY9 | 4-106 | TQQPIDPKLNGEWSASEMVQEAPHSQVIIPQQERHHNGRFWTIEEHRQFLHGLRWYGLGNWKNISRDFITIKTPVQVSSHAQKYFCR… |
| A0A287M038 | 81-154 | REERRRGIPWSEEEHKLFLDGLDKYGRGDWRNISRFAVRSRTPTQVASHAQKYFIRQASAATRDSKRKSIHDIT |
| A0A0A8XPY3 | 4-93 | None |
| A2XS15 | 70-183 | None |
| A0A1D6FP50 | 93-178 | None |
| A2WSA6 | 1-83 | None |
| G7I8N4 | 3-130 | None |
| A0A6A3AS97 | 90-185 | None |
| A0A830BWK8 | 72-148 | None |
| A0A803KXG6 | 51-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.