DPCstruct | MC28851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2I3D6 | 1-107 | MSTLTKALFLVALCIPIVVVAEEPYKITGSSGIISFVAVDSAQINNEDVYRYAVAEACAGKKMCQVQYWADNAPSKFPLTDAQADSK… |
| A0A349Y2U5 | 1-118 | MRKLVVLALLSALVSCGGSGPKVWRVVAKQGDFHFVEIDERFAGNADVIGRAVADVCKEKRFCFVGVWSSKDRTPSALPMSDDAVAT… |
| A0A4R1Z3Y4 | 1-106 | None |
| A2SHU3 | 75-189 | None |
| A0A0L1KEZ6 | 1-116 | None |
| A0A2W5NVM1 | 198-308 | None |
| A0A0S7ZN70 | 5-140 | None |
| A0A2K2G3I6 | 93-202 | None |
| A0A411LPJ3 | 259-372 | None |
| Q1IQL6 | 342-466 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.