DPCstruct | MC2884
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 52 ± 3 aa |
| Standard deviation of domain lengths | 3.26 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8EF08 | 3-54 | VYKYLTGKDDVNFCARVTQALNDGYELYGSPTMTFNGTDVIVGQAIMKDIAD |
| A0A4Y3KY56 | 31-81 | RLRYRLLTGPDDRTFCERISAALDEGYVLHGGPAATFDGTRVIVAQAVVLP |
| A0A7G2SB30 | 22-68 | None |
| A0A7K0YW27 | 86-140 | None |
| L8TQQ4 | 8-62 | None |
| A0A6M1M0P1 | 1-52 | None |
| A0A172YG58 | 10-67 | None |
| A0A521SI58 | 1-50 | None |
| A0A3B9FH37 | 2-56 | None |
| A0A2W6PN36 | 84-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.