DPCstruct | MC28838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 208 ± 34 aa |
| Standard deviation of domain lengths | 34.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03353 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| O44809 | 10-172 | NPPPPPRAITPLPPATHRITMDEYKKREKKDYYRDATKDASVKKVVLSLLKDYPDMWQNGNRFQTRKWRALGVEVYQRTGQIVGVDD… |
| A0A1I7U209 | 3-171 | PTRPKPLYQLNPLTHPLPPILFETSLDEYRKVDHDGHKNKWIREVILRLIYNRPELWLAKNVKVKAIQWEEVGLELFRRTEQALSIS… |
| A0A1I7UDR6 | 1-155 | None |
| Q17812 | 2-198 | None |
| G0NDZ7 | 415-632 | None |
| G0M7I6 | 18-203 | None |
| B6IE83 | 186-384 | None |
| Q21395 | 8-181 | None |
| A8XW16 | 31-333 | None |
| E3NUT0 | 11-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.