DPCstruct | MC28837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 173 ± 25 aa |
| Standard deviation of domain lengths | 24.52 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4VVQ8 | 2-140 | EPCEGPCHASYEIETMVALPCCQVYMCQPCAKKWTEGKGTCPPGKCLQKGGSKIKTPCSGMPDCEGEVLRNFPSEMECEHEVCINCL… |
| A0A1I7TV88 | 1-197 | MMIDEEDLVCEGPCKQPLAFDKTIIIPCCGARMCNECGLKWTNGRDFCEPGKCVIKDSGKKKKVPDTVTLFHESAIPQCSQARQPCT… |
| H2KYS7 | 109-280 | None |
| A0A0N5DA36 | 182-363 | None |
| A0A1I7VSV4 | 1-226 | None |
| A0A158RBC1 | 64-227 | None |
| A0A0N4TG54 | 23-190 | None |
| A0A0K0CUS6 | 1-140 | None |
| A0A4E9FAB9 | 102-281 | None |
| A0A0N4TNE2 | 1-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.