DPCstruct | MC28832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7DLK3 | 11-116 | FLTGSMFTLQAQKMNAPSSQADKPIDIIKVYEMVVAEGYESSQIFETLATENFYLSNFEEAKKWFEKLFALNPNPEPLAYYRYAKSL… |
| A0A2D9B954 | 16-125 | LMSKLVAIILLFFLGWNSTASAQEKTVDVNKDIAITKVYEQVVKEGYGTPKVYLDLANAHYFEGNYASAKKWYEKVFETEKTLINRV… |
| A0A4R5CSQ7 | 1-122 | None |
| A0A1A9LEG5 | 43-155 | None |
| A0A653TZ18 | 95-203 | None |
| A0A2U1JJF2 | 127-247 | None |
| A0A2D8X957 | 1-100 | None |
| A0A4Y4AZZ5 | 116-233 | None |
| A0A258JKQ5 | 41-171 | None |
| A0A6G6GP85 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.