DPCstruct | MC2883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 218 ± 19 aa |
| Standard deviation of domain lengths | 18.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2EIL2 | 40-240 | AEVVLTGIALAATAVGPNILVVALTPGMPGMDVLGPWLLVPAITALLVVWLVAFRLGQTRLANRIWTGIWVGAASTAALDAIRLTGF… |
| A0A4Y3KWL5 | 1-240 | MPGEDPDADVRESESADPASTRTGGRRLLTLLVPGGVFLLSGASLVVYVLTGAPMALVLALLVVLGVGAVALTLRGEPERRRAWSVR… |
| A0A535FA99 | 120-343 | None |
| A0A4R6USZ0 | 3-208 | None |
| A0A511D0X0 | 24-235 | None |
| A0A1Q7BPC3 | 1-262 | None |
| A0A1X7N0L4 | 5-203 | None |
| A0A3D4YYP3 | 4-201 | None |
| A0A534T0S1 | 1-221 | None |
| A0A7T8YT74 | 3-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.