DPCstruct | MC28825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 103 ± 8 aa |
| Standard deviation of domain lengths | 7.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A387G933 | 5-107 | LLAQDILDGAAVRDRPNLFVIGIFDRRITFYSQQVRALSLVHALKELGYLHANPRIAVVGGGAAGVTAAAAAALVTGSQVVLFESAD… |
| S9P5R7 | 16-106 | IEPKDILRHMGVPEEPGLYVLGCFERRVTLLSQQVRALNLVYALCERNLLLPEGRVCVIGGGAAGMTVAAAAARRGGRVVLLEQRSE… |
| A0A259DWN3 | 2-102 | None |
| A0A7W8MEQ8 | 1-105 | None |
| A0A848FNT9 | 6-122 | None |
| A0A8A3KR66 | 8-99 | None |
| A0A844ZBD1 | 379-487 | None |
| A0A3E0FN25 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.