DPCstruct | MC28823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 8 aa |
| Standard deviation of domain lengths | 7.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H1N8K5 | 204-321 | QQHIAQQVTGADVVFDCTDDDAGRMRLSRFSYAYLTPLIDCGIQVSAAGDGHVQDITGRVTVLHPGAACLICRNRVSTEIAAAQERS… |
| A0A5R9EJQ6 | 21-143 | AATFRAAPYELSVVEPAGFAAAADCDVIFSCVDRPWPRAVLNLLAYAHLIPVVDGGIAVDARGGRLRGAEWRAHIAAPGRACLECLG… |
| A0A1Q7REA6 | 18-141 | None |
| A0A6A7MI48 | 1-129 | None |
| A0A1E2S384 | 163-291 | None |
| A0A7W1EK65 | 340-460 | None |
| A0A2G9DZ14 | 145-253 | None |
| A0A7X6CRA5 | 188-301 | None |
| A0A176KZG0 | 2-105 | None |
| A0A2M7KWC9 | 288-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.