DPCstruct | MC28822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 130 |
|---|---|
| Mean domain length (aa) | 135 ± 26 aa |
| Standard deviation of domain lengths | 25.75 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T0JRM1 | 1-132 | MKIDLSSSDETELLGAALWRALPKKCLLFLYGDLGAGKTTLVRGLLRAAGHAGSVKSPTYSLVEEYRLADRAVFHFDLYRLKDPEEL… |
| A0A6M5XPP1 | 152-275 | RQLSWRDEDHTRAFAERLAAHPAIADAFITLQGELGAGKTTLVRHLLRALGVQGRIKSPTYAVVEPYEVGGRAIWHFDFYRFDDPRE… |
| A0A6L7YI51 | 1-103 | None |
| A0A7J6LSM3 | 31-172 | None |
| A0A0G1NSF1 | 4-116 | None |
| A0A7V2MDS4 | 60-202 | None |
| A0A536S2H4 | 254-393 | None |
| A0A5J4Z3D2 | 74-241 | None |
| A0A7C8CQW3 | 36-197 | None |
| A0A383WI28 | 169-369 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.