DPCstruct | MC28821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 164 ± 28 aa |
| Standard deviation of domain lengths | 28.28 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3Z7P1 | 38-216 | KFMLSGTLMLSILCVVLGVCSQQIFNIMGYSFQLPNMLFIGVILAGFYLLSWATLRALTKNKIRITKTWGCGFTSQSSKMEYTASGF… |
| A0A847GER1 | 5-172 | AGLAPAVGVLTGGTPEMIRGALGAAANPLVWIVVVSTMLALLTTALAVLRNRLLSGRTVAAAGTWDCGYAAPTARMQYTASSFAQPL… |
| A0A7X9KX16 | 11-174 | None |
| A0A7X6USM3 | 136-320 | None |
| A0A109S5U1 | 1-213 | None |
| A0A532E1D5 | 74-270 | None |
| A0A2V8HZ60 | 10-123 | None |
| A0A831P851 | 20-233 | None |
| A0A2N1TPI3 | 23-186 | None |
| A0A2I1DM15 | 811-950 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.