DPCstruct | MC2882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 127 ± 18 aa |
| Standard deviation of domain lengths | 18.11 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 73.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 36.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2KHR3 | 5-124 | CVNSVDNFCYICGELTFAAQQNIISAVVKKAYHLYFGCKIGDQDKYWAPHVCCRTCAITLSKWFHGKRKAMPFAVPVIWREPTNHID… |
| A0A4C1XAF3 | 19-161 | LTVKRQRRSLTPLVQNCYLNYFGFPVRNLDKTWTPSICYAQCVTLLTSWAKGSRHMPFAVPMIWAEPKDHVSDCYFCQTSIKGINHK… |
| A0A822C9X0 | 2-118 | None |
| A0A0J7K7W5 | 4-110 | None |
| A0A4Y2BAE1 | 3-97 | None |
| A0A0J7KEC0 | 1-105 | None |
| A0A4C1XJS6 | 14-139 | None |
| A0A4Y2ELX8 | 55-159 | None |
| A0A4Y2BZ87 | 5-119 | None |
| A0A4Y2BMT9 | 22-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.