DPCstruct | MC28817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 137 ± 26 aa |
| Standard deviation of domain lengths | 26.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 91.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257Q3R9 | 74-213 | QQPLNNFYQDFKNEALVVDKWFSLQAVAEATDVKAVRKLMTHPAFTLKNPNRARSLVFSFCNGNSSQFHAADGSGYAFWTEQVIALN… |
| A0A7S1JBW9 | 49-162 | SPGMDSTGMSLLMKHEAYDLKNPNKVYATVGGFASVPVNFHKIDGSGYKLVADVIKQLDPINSQVAARIAGLFTQWKQVAPIERQTA… |
| A0A072U5E7 | 19-138 | None |
| A0A7S0LUS7 | 25-136 | None |
| A0A812NHE2 | 1030-1173 | None |
| A0A7R9WSE0 | 38-181 | None |
| A0A2G2PGA7 | 1-111 | None |
| A0A7S1KEH5 | 271-408 | None |
| A0A4Y7IZC2 | 289-429 | None |
| A0A7R9XRE3 | 63-202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.