DPCstruct | MC2881
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 76 ± 5 aa |
| Standard deviation of domain lengths | 5.24 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 54.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1YRL1 | 1-72 | MEPGFVKANSSNLPRIDLLMLGEFLATNKEFCSSEFRNVKTSLSSRPSYGDDAISYVQLKREGNICTVKCKI |
| A0A4C1X5S1 | 242-312 | KVEKDFIKADSANLPKVDSFMIANFFASNPDFCSAEFRNVKTSVSSRQSYGDDDIGYVQLKRDHTLCTVKC |
| A0A4C1V0K5 | 1-83 | None |
| A0A835G5M7 | 1-76 | None |
| A0A835L002 | 1-82 | None |
| A0A3Q0J6X0 | 1-81 | None |
| A0A4C1ZD19 | 1-67 | None |
| A0A4C1Y777 | 1-72 | None |
| A0A4C1YDU6 | 1-72 | None |
| A0A811W4P3 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.