DPCstruct | MC28803
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 193 ± 16 aa |
| Standard deviation of domain lengths | 15.53 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401GYT7 | 156-354 | PEMRMRGLDVLDGPPSDEESDIDRVAQRIWRQFPNDLIQVSPNYKKRSDGPYTTLTRTEQDNATAEVFLSFEIPFREFYVRYVSQEH… |
| S8DML5 | 23-217 | VAEVEEPDGMDARLSNFWFQMLFDVMRKAPNPRSCVLPSYMDMKPIECTQIEEDFFKTFELPFRQVRYKVVEFDYWQNTMFNRFFPP… |
| A0A836DC12 | 455-655 | None |
| A0A0C3D4H5 | 5-183 | None |
| A0A0D2NWI1 | 184-368 | None |
| A0A0C9U057 | 4-222 | None |
| A0A6A4GL36 | 662-844 | None |
| A0A5N5Q7I5 | 36-250 | None |
| K5VN79 | 190-370 | None |
| A0A4Y9XQS2 | 196-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.