DPCstruct | MC28800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 185 |
|---|---|
| Mean domain length (aa) | 109 ± 17 aa |
| Standard deviation of domain lengths | 17.24 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 99.47 |
| Assigned Pfam label(s) | CL0164- CL0513 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S7NR31 | 127-231 | PKFTVPQINCDVKAGKIINPEFIVKCPAGCQDPKYHVYGTNVYASSSSVCAAAVHSGVLDNSGGKVLVQKVAGQSGYRASYSNGVQS… |
| A0A7V3G049 | 9-95 | TSYRNKVGEVFYFKVTGALGGTVYGTGIYTDDSSLATAVVHAGLVAVGETAEVKVTIMPGQDSYRASTANGVTSLSYGRWQGSFRVE |
| C3ZHS4 | 169-257 | None |
| A0A446PIN8 | 113-222 | None |
| B4DRU4 | 29-145 | None |
| A0A6B1ARL2 | 153-287 | None |
| A0A847ASW2 | 129-251 | None |
| A0A7K1UJF8 | 624-737 | None |
| A0A7S0ASX5 | 318-440 | None |
| A0A6A3TY33 | 98-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.