DPCstruct | MC2880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 83 ± 10 aa |
| Standard deviation of domain lengths | 10.27 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q0CAL9 | 4-83 | MRKNSCDQITVRQHRAPIIALECDICDRRTDLDRKVVVRQFGASLPLRQLRRRLTVGCSRMNCADSIDRCQARFLDMDVG |
| A0A809ZGE7 | 1-66 | MKLGAWPLPYVRVKCSKCDREGRLSKDGLIERFGPDREMFVVREKLTEPSCKRPDKKQPCQSVLPD |
| A0A0E0UKJ3 | 4-78 | None |
| A0A5C8TPX5 | 2-73 | None |
| C3MAU4 | 2-89 | None |
| A0A1W6RGV6 | 3-88 | None |
| A0A2S4MCJ2 | 97-204 | None |
| A0A512JPA0 | 9-109 | None |
| A0A2T4Y9C4 | 9-96 | None |
| A0A1I4P9N5 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.