DPCstruct | MC288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 186 ± 23 aa |
| Standard deviation of domain lengths | 22.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7WEV8 | 127-299 | ASLVCEGFAGQARAVSPGLGCAWLPVVEMPGYVDSLSNAELRDMVLSHTANAVVKCLTAQPAPPGKAARVYSPTEIVATGDFNEIND… |
| A0A2V7CGG5 | 1-216 | MIGTTVFQGLAVSELGALGIIGLPLVMIEHPLGGERSEGIARRARQAVDQLTKALNTPTGATPGEIGRAEPGRTFLGPPSVQADLTD… |
| A0A2V6QB30 | 1-226 | None |
| A0A538DGU3 | 16-188 | None |
| A0A7C1CYK0 | 190-361 | None |
| A0A847DBW8 | 16-191 | None |
| A0A537MM36 | 233-463 | None |
| A0A1V5C6Q8 | 5-179 | None |
| A0A8B0KSU3 | 3-179 | None |
| A0A6M5XTT3 | 829-997 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.