DPCstruct | MC28797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 231 ± 38 aa |
| Standard deviation of domain lengths | 37.92 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.03 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF07196- PF00700- PF06429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0WYA2 | 5-177 | DYQPSYDLQSGSDLLLSKATNVDAKDTASYRVTFVDMNNGKFGYQLERNGKVVDADEFSPEKGIEYKGLKVHVKGQITPGDSIGIEK… |
| A0A7C4YK40 | 14-240 | MGGANDIYTFTVLGSGTVGVTPGLTLEVRNGAGALLNTINIGAGYTPDTLIHAADGISFRLSAGTTNNGSFSSRVIAEPDTAGILPS… |
| A0A825KXC3 | 113-395 | None |
| A0A1E3GZ28 | 4-207 | None |
| H0T790 | 4-320 | None |
| A0A6C2C8Q0 | 2-186 | None |
| A0A7X8FUT3 | 3-256 | None |
| A0A7X6YWV8 | 1-246 | None |
| A0A257SSS8 | 159-377 | None |
| A0A7X1GQK5 | 45-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.