DPCstruct | MC28791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 419 |
|---|---|
| Mean domain length (aa) | 195 ± 41 aa |
| Standard deviation of domain lengths | 41.43 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535CNB9 | 293-488 | TVRMAGHQIPWVTDPAMGGEWVVNNRLHIQTYRPLLEQRPGPNLVPGVAESWSVSDDGLVYQVRLRADATWNDGRPIAAQDVVWTYR… |
| A0A101FAS2 | 11-185 | TVYIGGALWGPATTWNLYAPQSTWGTDQFMYLPAFQYDLGRDAWIPVIAERYEFVDDKTLRIYIRPEARWSDGVSITAEDFVYALEL… |
| A0A1M3PLE8 | 3-105 | None |
| A0A6A0JR17 | 60-225 | None |
| A0A534KI30 | 27-242 | None |
| A0A6N8W0C9 | 109-305 | None |
| D4K944 | 9-224 | None |
| W7ZWB5 | 2-126 | None |
| A0A1Q9SX53 | 30-251 | None |
| A0A1Q9SN32 | 16-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.