DPCstruct | MC2879
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 10.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 55.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00940 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A804LR19 | 81-154 | AEDPFQCLAACMDLSDALRSPSPYHAVSHLPIHQDGSCNGLQHYAALGRDYMDAVAVNLVPGEKPADIYSEIAS |
| A0A6I9V3D1 | 102-175 | AEDPFQCLATCINLSEALRSPCPESTVSHMPVHQDGSCNGLQHYAALGRDKLGAAAVNLVAGDKPADVYSGIAA |
| A0A3P7Q062 | 41-133 | None |
| A0A5B0Q324 | 6-105 | None |
| A0A1D6N946 | 244-317 | None |
| A0A2S2NA20 | 241-326 | None |
| M0ZLT1 | 598-671 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.