DPCstruct | MC28785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 5 aa |
| Standard deviation of domain lengths | 5.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 37.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10045 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J1LWM9 | 1-77 | MAALSTEVKAFIVQSLACFEPPTKVIELVKQEFGVEVSRQQVSQYSPGNAMAANLSKKWVELFHSTRERFQSEISNI |
| A0A3G2IHS6 | 1-77 | MAALTTAVKAYIVQALACLDTPSQVVKAVQEEFGLVITRQQVESHDPTKANGKKLAQKWVELFHFTREQLQKELSGI |
| A0A7D4I387 | 1-68 | None |
| A6UJ09 | 2-80 | None |
| A0A4Q6X332 | 1-84 | None |
| A0A090EPH5 | 4-79 | None |
| A0A402D5P7 | 35-122 | None |
| A0A1H8PPS6 | 1-79 | None |
| H0G939 | 4-75 | None |
| A0A2G0WHB4 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.