DPCstruct | MC28784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 4.65 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 26.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S6D4U9 | 2-82 | LNITCIVPTVWNYYPDFLVELLVHAHLVEHWNHHHSLTGVTITLAEVTAVSEYYVLDIIWFRIVGDVTDDPFHDDYYVLSI |
| S6D321 | 2-80 | VLEVIVPQEWQVLPEATLRTELLYLITIQETQRATSAFGVYNGVTAKSLEFNGYLWFKKLNDLNEEPDFNIYVLLEIPF |
| B7S8K5 | 13-93 | None |
| B7S8M6 | 1-88 | None |
| B7S947 | 1-81 | None |
| B7S953 | 77-164 | None |
| B7S929 | 118-197 | None |
| B7S944 | 31-121 | None |
| S6D9K7 | 1-82 | None |
| B7S941 | 9-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.