DPCstruct | MC28783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 396 |
|---|---|
| Mean domain length (aa) | 138 ± 29 aa |
| Standard deviation of domain lengths | 28.59 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.55 |
| Pfam Score | 62.08 |
| Assigned Pfam label(s) | CL0059- PF21307- PF17137- CL0749- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5IYP9 | 183-324 | IKDYWGGMLREGATSFWEKYNPEETGTQHLAMYGRPYGKSLCHAWGASPIYLLGKYYLGVTPEEAGYREFRIAPNLGGLKWMEGSVP… |
| A0A854C564 | 19-153 | IESPLTTLWEGWGIGSEGFGGGTYNHAWSGGPLTILSQYIAGIETLEPAFRMFRVAPHPAHLNFIRTLVPLSGGRRIVFEMDKSAHG… |
| A0A1V5Z6L0 | 320-454 | None |
| A0A7V3AF73 | 124-264 | None |
| A0A370IIF7 | 5-115 | None |
| A0A396QHN3 | 163-296 | None |
| A0A4S9JGL3 | 54-207 | None |
| A0A355IX67 | 2-117 | None |
| A0A370PBT8 | 230-389 | None |
| A0A518AMG0 | 641-812 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.