DPCstruct | MC2878
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 163 ± 17 aa |
| Standard deviation of domain lengths | 17.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 91.00 |
| Assigned Pfam label(s) | CL0010- PF17208- PF12140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485MLA2 | 1-180 | MTPLALSPPRSTPEPDLSSIPQDAATIPSLAAPQALTVCLYINKQANAGPYLERRKVQQLPEHFGPERPSAVLQQAVQACIDCAHQQ… |
| A0A060Z7K2 | 12-144 | QWEILIYVNHRCFSGPYLNKGRIAELPQAVGPGKCTLVLKEVLSMLINAAYKPGRVLRELQDVEDQHWDCHEETLKAKYKGKTYRSS… |
| A0A2A6C8J6 | 493-631 | None |
| A0A6L5CEG5 | 239-407 | None |
| A0A4W3HJP6 | 60-227 | None |
| A0A0B1PKP5 | 192-354 | None |
| A0A7J5Y802 | 54-223 | None |
| A0A5C6MFG2 | 3-138 | None |
| A0A4Y2AT29 | 199-376 | None |
| A0A1Y3EIB0 | 322-477 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.