DPCstruct | MC28779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 165 ± 25 aa |
| Standard deviation of domain lengths | 24.99 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6QES6 | 16-161 | LASASYNDERGPPPHPFWRRSNVPPQGYFDPKDNGGSLLTQVPGTFPAGLGEPLNVIMSANSDSDVLKDQETDGGLRNYFLSLGYSS… |
| A0A166EDS0 | 1-156 | MSRRSNVPSDGFYVPAANGGSQLTIVEDTFPAGLGEPINVIISAKSDSAVLKDQPNDGGLRNYFQSIGFSGECLGQHEGDDQQADLG… |
| A0A146ICU5 | 786-968 | None |
| A0A4T0HV42 | 41-172 | None |
| A0A4U0W6V3 | 402-578 | None |
| J8TJD9 | 1-168 | None |
| L0I7Q1 | 23-221 | None |
| A0A0C3BWD2 | 2-142 | None |
| A0A146I6Q5 | 3-153 | None |
| A0A166I997 | 1-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.