DPCstruct | MC28777
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 2.97 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.58 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | PF06682- PF03169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1SZ51 | 29-97 | VLLRDVNAITLREGQYTTGRRSAPVPQLKCVGGSAKGQYKPRIVQCVKQGFDGIDYQWKCTADMPHEFE |
| A0A2R6PBW8 | 1-71 | MSRVALSKIKSLTFYKDSLTTSRRDGPIPQLNCIGKPCNLYTPDAVRCVSVGGEGTDVDWKIYLKLYDSEE |
| R9P7W4 | 38-97 | None |
| F8PY25 | 1-66 | None |
| A0A166E2Z7 | 63-130 | None |
| S7Q2B5 | 585-648 | None |
| L8WM53 | 52-116 | None |
| A0A511KN39 | 5-72 | None |
| A0A0W0EXT3 | 1-66 | None |
| A0A6B0R5I8 | 20-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.