DPCstruct | MC28771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 13 aa |
| Standard deviation of domain lengths | 13.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4V4D4 | 1-131 | MPFNILSVAFHASFTAISTGVIHYLGKKPAQTEPTAHFSYHSGLEVVRRFLEHAARHTVEELQAFTGQKVPTPYWVATGSIIIPAEC… |
| A0A2R6NQT0 | 1-158 | MVNSLTRSAGVRLGPLLLETLVKHYFERVAHDNASQGRVMTKLRQDELLYDEAFIVVKTFLEASTKHTVEELQKFSNTRTPAPPWVQ… |
| A0A5B0Q9T9 | 1-137 | None |
| A0A0B7F446 | 1-157 | None |
| A0A5K1JTH0 | 2-130 | None |
| K9FQD7 | 360-475 | None |
| A0A1E3JII9 | 1-151 | None |
| A0A178ZQT5 | 5-140 | None |
| A0A0C3QVX7 | 3-156 | None |
| A0A2X0M7Z7 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.