DPCstruct | MC2877
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 453 ± 65 aa |
| Standard deviation of domain lengths | 64.80 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068S191 | 37-470 | NWKELVALVSGRMTRSMLTTTVNTEPVLKKLVAQGDVVGPQRNTQLLAFAQDSAHMDDEEMTVSLGCIPANEDKAFIGTRYYVRSAQ… |
| A0A068RRG6 | 19-378 | YHSIQRLMSCTLEVPDSELEQLLGIHQATIDRPSIYIRSWTISPDTLAALLANLALHLSSHPLLRIWRQYQQANPDKAIHLRYVGST… |
| A0A0E9NQV4 | 95-594 | None |
| A0A4U0XHJ9 | 1-332 | None |
| A0A067PSQ7 | 230-615 | None |
| A0A238FH60 | 2-513 | None |
| A0A1J7IND5 | 18-546 | None |
| A0A077WWR1 | 6-444 | None |
| A0A077WND2 | 33-393 | None |
| A0A395H565 | 4-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.