DPCstruct | MC28769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 178 ± 26 aa |
| Standard deviation of domain lengths | 26.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6NGL8 | 1-195 | MSVTDPRRREIFVNVPAVRGQTEQSFEEARIQDYVKAYTATGRPPQPCPEHPTDPAERVRLGLPPIFEPYIEVGGTPVSQSQGSSTT… |
| A0A401GFC0 | 1-161 | MVHVKRVELHMYVASVRGGKEESFEELRVEDYIHAYEKTGKPPAPCPQVPTDDAERATLGLPPLFKPRTVVPPEFPETHVFRPTADP… |
| A0A0C2ZQR7 | 3-182 | None |
| A0A5M3MN38 | 42-217 | None |
| K5VQD4 | 1-172 | None |
| A0A4V4HC61 | 101-263 | None |
| A0A0D2PKG9 | 2-243 | None |
| B8P905 | 1-141 | None |
| J4I9E3 | 1-205 | None |
| A0A0L6WVD7 | 15-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.