DPCstruct | MC28764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 298 ± 57 aa |
| Standard deviation of domain lengths | 57.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P0ZLV3 | 4-259 | MTERGRIPTHEEIPAAEVICQKFGSLRKAFQVIVKATDSEEWEEIADKRRQDLLVYLALCKFSHRPRLGKLPPAIQEDILGLYSSYK… |
| K0V439 | 7-315 | APGVFYVFREAADAQAFLANRVHTYRPRLRIDAHDLYEAHQAVLEPLLSFMKAHGRAPRAGEVSQQWASAIKDAVGSLGRAQQLIRK… |
| A0A517M1E5 | 139-467 | None |
| A0A6M1LU00 | 1-225 | None |
| A0A848A5X9 | 102-358 | None |
| A0A5S4FPX0 | 56-348 | None |
| A0A2D8J7E2 | 35-380 | None |
| A0A4R2S9R0 | 277-631 | None |
| A0A7X8XNF5 | 159-495 | None |
| A0A0F0EBD7 | 338-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.