DPCstruct | MC28761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 495 ± 70 aa |
| Standard deviation of domain lengths | 69.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0268 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383TW23 | 67-597 | KVIFPKGRYDFYATGSFTREYYISNHDQLNPKNVAFALENLENITIDGQGSEFIFHGRMIPFSIIKGENISLQNFSIDFENPAFRQL… |
| A0A2U1ACT0 | 8-506 | NLERMRDFIFDGGGATFVWHKKREANFRLNGCERIVMRNFKMDWDWEKDPLASLVEVVGASAGHVDFRFNDYETFPRRDVRVIVVSS… |
| A0A817KG99 | 14-360 | None |
| A0A2P6NPR7 | 45-560 | None |
| A0A2P6P0H9 | 265-801 | None |
| A0A7C3I8I1 | 103-547 | None |
| A0A317ZHH5 | 92-633 | None |
| A0A819N9M0 | 9-369 | None |
| A0A292FV73 | 24-581 | None |
| R7LAA4 | 206-739 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.