DPCstruct | MC2876
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 82 ± 4 aa |
| Standard deviation of domain lengths | 3.81 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A068RGU4 | 1-88 | MSYVAADKAESELAASIKKATSIDETAPKQKHVRKCIVYTWDHRTSGVIWSILKVQPILSDEVQTFKALIMVHKIIKDGHPIVIKDAC |
| A0A443SBU6 | 13-96 | VEREYFEKCQAISVAKALNGSESPVKEKHVRRILIGTFKDQNSVLFWSIVRKLPLQENPIVCWKFCHVLHKILREGHRKSLSDA |
| A0A3P7II19 | 4-84 | None |
| A0A814PY49 | 28-107 | None |
| A0A3Q0FPQ4 | 3-80 | None |
| A0A504Z1K4 | 6-92 | None |
| A0A183DCG5 | 3-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.