DPCstruct | MC28759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 172 ± 25 aa |
| Standard deviation of domain lengths | 24.65 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0331- CL0037 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A8IF62 | 231-378 | NDPVTKDLDPTKKALLNAIAGGESGGRYNLRWSPKGTALFNDFSKHPRIFEPGPEGPSSAAGRYQITATTWDRIMGPNTPFTPENQD… |
| A0A0J6BCN4 | 20-179 | PEAAQGNARYALSDQRRALLETIRYAEGTWRNGSSDGYRTLYGGSLFQGLARHPEITVRRRYTSAAAGAYQFLPGTWREVAGQLRLR… |
| A0A3D1PHP1 | 5-163 | None |
| A0A809RLF6 | 413-561 | None |
| A0A0M5KL94 | 155-297 | None |
| A0A522XMH6 | 187-375 | None |
| A0A7Y5D8U0 | 315-500 | None |
| A0A0S9REZ8 | 2-131 | None |
| A0A2G9WPI4 | 289-423 | None |
| A0A3P3DJL6 | 84-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.