DPCstruct | MC28756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 6 aa |
| Standard deviation of domain lengths | 5.68 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18828 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4THQ6 | 1-107 | MASLRETAQRVLQEARDGIAWIAFYKEGRGWGAECFWPEYHDKSNDFCHDKDDLAELRDILKADRNAIFVNGYYTNLGSTLEMTRES… |
| A0A494WNS6 | 1-99 | MASLRDTVKDYQDELRDGIAWVAFWKQGRSWNAEYFHLDMDDTLYPEDRSRLEEIKSIDPAAVILNGYYCGYLGEDMSLDELTAGVR… |
| A0A1Y4RUL6 | 3-106 | None |
| A0A351TNT5 | 1-99 | None |
| A0A381I842 | 1-110 | None |
| R9IH64 | 1-110 | None |
| A0A4P8A5J2 | 1-91 | None |
| A0A7X5DCK0 | 1-109 | None |
| A0A3A9H7N8 | 19-128 | None |
| A0A416JJB5 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.