DPCstruct | MC28751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 138 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0W0Y429 | 19-153 | AKRHLEQLIKNYQLCPKLCGLEKTNSVCFSFQLGRCLGACNEEEGALSYNKRVHEALTLFKNATWPYPGSIAIKEQHLKRTSWLLFN… |
| A0A1V5FDK3 | 2-129 | YRLCPRRLGLEGGSGPCTAHAARRCAGVCARRETPEEHDARLAGALAGVGVKPWPWAGPVAVEEVRAHGQHRLQVFDRWCHLGSAQD… |
| A0A849D3E8 | 208-344 | None |
| A0A4Q3R7X7 | 1-117 | None |
| A0A660N292 | 70-212 | None |
| A0A7Y2TIX1 | 2-135 | None |
| A0A2N2WAJ9 | 33-181 | None |
| A0A6D0M7N9 | 53-193 | None |
| A0A895ZHQ8 | 5-112 | None |
| A0A080LT41 | 28-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.